Commit 82a1fcf6 authored by bow's avatar bow
Browse files

Biopython tutorial & example files

parent 51ec9633
This diff is collapsed.
@HWI-ST1019:196:D121WACXX:5:1101:1538:2300/1
CCGCGACCTCTGTTCTGCAGCCCCTTCCCTTCCCCGCCTCCTGCTCTGCCGGGACTACGCACCGGCCTGATTGGTTACCCCCGGGGTGTCCTCGGTCACCA
+
1+++4)<@<A<+2A9A2++:3C8:)1?BDBDBBDC@::6@(.8..7)777:<?@@##############################################
@IRIS:7:1:17:394#0/1
GTCAGGACAAGAAAGACAANTCCAATTNACATTATG
+IRIS:7:1:17:394#0/1
aaabaa`]baaaaa_aab]D^^`b`aYDW]abaa`^
@IRIS:7:1:17:800#0/2
GGAAACACTACTTAGGCTTATAAGATCNGGTTGCGG
+IRIS:7:1:17:800#0/2
ababbaaabaaaaa`]`ba`]`aaaaYD\\_a``XT
@IRIS:7:1:17:1757#0/1
TTTTCTCGACGATTTCCACTCCTGGTCNACGAATCC
+IRIS:7:1:17:1757#0/1
aaaaaa``aaa`aaaa_^a```]][Z[DY^XYV^_Y
@IRIS:7:1:17:1479#0/2
CATATTGTAGGGTGGATCTCGAAAGATATGAAAGAT
+IRIS:7:1:17:1479#0/2
abaaaaa`a```^aaaaa`_]aaa`aaa__a_X]``
@IRIS:7:1:17:150#0/1
TGATGTACTATGCATATGAACTTGTATGCAAAGTGG
+IRIS:7:1:17:150#0/1
abaabaa`aaaaaaa^ba_]]aaa^aaaaa_^][aa
@IRIS:7:1:18:443#0/2
CGATTCCACGTGATCAAAGAAACTAGAGTGGGTCTG
+IRIS:7:1:18:443#0/2
abbbbbababababababbaaaababababa``aaa
@IRIS:7:1:18:622#0/1
TGGGCTCCGGGAGGGGGGGATGTAAGAAAAATTACA
+IRIS:7:1:18:622#0/1
ababaaaabaa_``aa``]^aa_`aa_Z_aaaaa^b
@IRIS:7:1:18:628#0/2
AAAACAATTAGATGATGATAAAATTAACAAAGATTG
+IRIS:7:1:18:628#0/2
aaaaaaaaaaaaaaaaaa`^```a`aaa`^`a`a^a
@IRIS:7:1:18:1642#0/1
AATAAGTTTTAAACAGCTAACCTTGTTTACTTCTTT
+IRIS:7:1:18:1642#0/1
aaaaaa_aaababba_baa\aaaaa`a`baaaaa`a
@IRIS:7:1:18:1260#0/2
AGATGTACAAATTTGTATTTCAAGACAGATTTATAA
+IRIS:7:1:18:1260#0/2
abaab`bab`abaab`bbaaab_babb]aaaabba^
@IRIS:7:1:18:16#0/1
AGGTTCGTGTTGAGTGTTGCCTCTTTTTCTGTTAAT
+IRIS:7:1:18:16#0/1
abb`bbbabbbaWa`baba_Z``babaa[_aa`\X_
@IRIS:7:1:18:1150#0/2
AGCTAGGTAAAGTTATACATACAGATGGCCGAACTT
+IRIS:7:1:18:1150#0/2
abaaabb^bbabaabbbaaaaaaaaa`W^`a`_^``
@IRIS:7:1:18:1819#0/1
CTTACCGCGGTTTTAATAATTTTACCATCACTTCGT
+IRIS:7:1:18:1819#0/1
abbbbbbbba[aba``ba`bbba^]]``___]`_^W
@IRIS:7:1:18:1232#0/2
AAGAAATATATCGAAGAGTTAGTGCTGGACTGGCTG
+IRIS:7:1:18:1232#0/2
a^aY\Y^]^Y[WYUBBBBBBBBBBBBBBBBBBBBBB
@IRIS:7:1:19:1343#0/1
GGCATCTCCAGAGGAGGCTGTACCTGTGGAATAGCA
+IRIS:7:1:19:1343#0/1
abbbbbbbbababaaba_a\FXQXNVKO^F[RWYSQ
@IRIS:7:1:19:1885#0/2
TGAATTTCAATACGTGCAATTCCCTCCATACCAGAG
+IRIS:7:1:19:1885#0/2
abbbbbbbbbbbabaa[a_aba_^aa^_a``UZaab
@IRIS:7:1:19:691#0/1
GACATGAATTGTGTTTTAGGATAATTGATTAAAAAT
+IRIS:7:1:19:691#0/1
aaabbb`aaab`baaaaaba`aaababaaaaaaaab
@IRIS:7:1:19:1159#0/2
CAAGAATCATACTCAACATGCAAGCGATGATGAACA
+IRIS:7:1:19:1159#0/2
`a^`bbabba\_a^[_a\\]][GY]YBBBBBBBBBB
@IRIS:7:1:19:1310#0/1
GGAGATGATTTGACGATTCGCAGTCGGATCATCTGC
+IRIS:7:1:19:1310#0/1
aaabbabbabbbbbbbbbbbbbbabbbaabaa^a^Z
@IRIS:7:1:19:1108#0/2
GGATAATAAGCTCATGGGTTTGGTCTTACTTCACCG
+IRIS:7:1:19:1108#0/2
abaaaaaaaaaaaaaaa`^aaaa]]a``_a`aa^_Z
@HWI-ST1019:196:D121WACXX:5:1101:1538:2300/1
CCGCGACCTCTGTTCTGCAGCCCCTTCCCTTCCCCGCCTCCTGCTCTGCCGGGACTACGCACCGGCCTGATTGGTTACCCCCGGGGTGTCCTCGGTCACCA
+
1+++4)<@<A<+2A9A2++:3C8:)1?BDBDBBDC@::6@(.8..7)777:<?@@##############################################
@HWI-ST1019:196:D121WACXX:5:1101:1538:2300/2
CCGCGACCTCTGTTCTGCAGCCCCTTCCCTTCCCCGCCTCCTGCTCTGCCGGGACTACGCACCGGCCTGATTGGTTACCCCCGGGGTGTCCTCGGTCACCA
+
1+++4)<@<A<+2A9A2++:3C8:)1?BDBDBBDC@::6@(.8..7)777:<?@@##############################################
File added
File added
>sp|P12464|RPOE_BACSU DNA-directed RNA polymerase subunit delta OS=Bacillus subtilis (strain 168) GN=rpoE PE=1 SV=1
MGIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYT
DLNIDGRFLALSDQTWGLRSWYPYDQLDEETQPTVKAKKKKAKKAVEEDLDLDEFEEIDE
DDLDLDEVEEELDLEADDFDEEDLDEDDDDLEIEEDIIDEDDEDYDDEEEEIK
Markdown is supported
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment